PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco002202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family YABBY
Protein Properties Length: 189aa    MW: 20872.4 Da    PI: 7.8504
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco002202.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY228.32e-7021642170
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                  +v+ ++e+vCyv+C+fCntil+vsvPs+s+f ++tvrCG Ct+llsv++   +q l+ +     + + +++++ ++++++ ++    ++s+  +++s 
  Aco002202.1   2 SVQIAPEHVCYVHCSFCNTILVVSVPSNSMFDILTVRCGNCTNLLSVDMGAVTQKLPLQGS---QKHAQQVHNIGSHHDHNSVDCGGSSSK-CNRRSP 95 
                  78899****************************************************9986...445556667777766655444444333.333443 PP

        YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                   l ++ +++  ++ p   PPekrqrvPsaynrfikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  Aco002202.1  96 VL-DSIQNDPHKTLP-TPPPEKRQRVPSAYNRFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 164
                  44.333344444444.68***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.6E-706164IPR006780YABBY protein
SuperFamilySSF470959.29E-9103158IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.104.0E-5113158IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSVQIAPEHV CYVHCSFCNT ILVVSVPSNS MFDILTVRCG NCTNLLSVDM GAVTQKLPLQ  60
GSQKHAQQVH NIGSHHDHNS VDCGGSSSKC NRRSPVLDSI QNDPHKTLPT PPPEKRQRVP  120
SAYNRFIKEE IQRIKANNPD ISHREAFSTA AKNWAHFPHI HFGLTHDNDK QHNEAIATHG  180
NPEACGLY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6636744e-75KM663674.1 Ananas bracteatus clone 48195 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010247861.13e-79PREDICTED: putative axial regulator YABBY 2 isoform X2
SwissprotQ10FZ76e-70YAB2_ORYSJ; Protein YABBY 2
TrEMBLM0TFM32e-77M0TFM3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P07830_0017e-77(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-63YABBY family protein